Broccoli Almond Soup

Broccoli Almond Soup

A comforting, creamy broccoli soup finished with roasted almonds for a nutty crunch and a protein boost – quick enough for a weeknight starter.

Prep Time 15 min
Cook Time 20 min
Total Time 35 min
Servings 4 servings
Recipe Category Soup Recipe Cuisine American Calories 203 kcal

Ingredients

  • ½ Cup Finely Chopped Broccoli Stalks
  • 1 Cup Broccoli Florets
  • 1 Tsp Roasted Almonds
  • ¼ Cup Finely Chopped Onions
  • 1 Tsp Finely Chopped Garlic
  • 1 Tsp Finely Chopped Celery
  • Salt To Taste
  • ½ Cup Milk
  • 1 Tsp Ground Nut Black Peppercorns

Servings: 1–2

Method

Direction:

  • To make broccoli and almonds soup/ heat 2 cups of water in a deep pan, add the broccoli stalks and cook on a medium flame for 4 to 5 minutes.
  • Add the broccoli florets, onion, garlic, celery and salt, mix it well and cook it for 5 minutes, while stirring occasionally.
  • Remove from the flame, allow it to cool a little.
  • Once slightly cooled, blend with a hand blender till smooth.
  • Transfer the prepared broccoli mixture into the same pan, add the milk,mix well and cook on a medium flame for 2 min,while stirring continuously.
  • Add the pepper powder, roasted almonds, mix it well and cook on a medium flame for another 1 min and serve it with a good garnishing.
Related searches:broccoli soupalmond soupvegancreamyhealthydairy-freegreen soup

Related Posts

Homemade Chocolate Hazelnut Spread (Nutella)

Make your own healthy chocolate hazelnut spread at home – a natural, preservative-free alternative that's just as rich and creamy as store-bought. Ingredients 2...
Post by Shipra Khanna
Jun 16 2026

Pumpkin Seeds Chocolate Candy

Sprouted pumpkin seeds blended with dates and topped with melted chocolate – a naturally sweetened, no-bake candy that satisfies a chocolate craving the healthy...
Post by Ayesha Ansari
May 15 2026

Alsi Ki Pinni/Ladoo

A classic winter sweet, these flaxseed ladoos combine roasted alsi with ghee-toasted wheat flour, jaggery and nuts – traditionally made to provide warmth and...
Post by Priyanka Aggarwal
Jul 16 2025

Cranberry Dark Chocolate Trail Mix

This no-cook trail mix combines organic dried cranberries, almonds, raisins, walnuts and pistachios with dark chocolate chips for a satisfying, protein-rich snack you can...
Post by Priyanka Aggarwal
May 03 2025

Walnut Chutney

A quick, protein-rich walnut chutney with a tangy yogurt base – ready in minutes and perfect alongside naan, roti or your favourite Indian snacks....
Post by Sarita Choudhary
Feb 27 2025

Cream Of Cashew Pea Soup

Raw cashews blended into the base give this pea soup a silky, dairy-free creaminess – a comforting, protein-rich bowl with a touch of heat...
Post by Maitri Ramaiya
Feb 03 2025

Homemade Flaxseed Hummus

This creamy hummus gets an omega-3 boost from ground flax meal, blended with classic chickpeas, tahini and lemon for a healthy, protein-rich dip. Ingredients...
Post by Monika Singh
Nov 30 2024

Chia Seeds Jam

Skip the refined sugar – this naturally thickened chia seed jam uses raspberries and a touch of maple syrup for a healthy, spreadable breakfast...
Post by Maitri Ramaiya
Oct 17 2024

Leave a Comment

Your email address will not be published. Required fields are marked *

Please note, comments need to be approved before they are published.